![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (6 families) ![]() |
![]() | Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) |
![]() | Protein Ribosomal protein L3 [50462] (4 species) superfamily fold is elaborated with additional structures |
![]() | Species Thermus thermophilus [TaxId:274] [159158] (11 PDB entries) Uniprot Q72I04 1-205 |
![]() | Domain d3d5be1: 3d5b E:1-204 [157357] Other proteins in same PDB: d3d5b61, d3d5b71, d3d5bh1, d3d5bh2, d3d5bn1, d3d5bo1, d3d5bp1, d3d5bu1, d3d5bv1, d3d5by1, d3d5bz1 automatically matched to 2J01 E:1-205 complexed with mg |
PDB Entry: 3d5b (more details), 3.21 Å
SCOPe Domain Sequences for d3d5be1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5be1 b.43.3.2 (E:1-204) Ribosomal protein L3 {Thermus thermophilus [TaxId: 274]} mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen lllvkgavpgpngglvivretkka
Timeline for d3d5be1: