| Class j: Peptides [58231] (133 folds) |
| Fold j.118: Ribosomal protein L34p [144320] (1 superfamily) non-globular, mainly alpha-helical |
Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) ![]() |
| Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein) Pfam PF00468 |
| Protein Ribosomal protein L34p [144323] (3 species) |
| Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries) Uniprot P80340 1-49 |
| Domain d3d5b71: 3d5b 7:1-48 [157356] Other proteins in same PDB: d3d5b61, d3d5be1, d3d5bh1, d3d5bh2, d3d5bn1, d3d5bo1, d3d5bp1, d3d5bu1, d3d5bv1, d3d5by1, d3d5bz1 complexed with mg complexed with mg |
PDB Entry: 3d5b (more details), 3.21 Å
SCOPe Domain Sequences for d3d5b71:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5b71 j.118.1.1 (7:1-48) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrk
Timeline for d3d5b71: