Lineage for d3d5b61 (3d5b 6:9-52)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066475Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1066676Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein)
    Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members
  6. 1066677Protein Ribosomal protein L33p [144204] (3 species)
  7. 1066695Species Thermus thermophilus [TaxId:274] [161180] (9 PDB entries)
    Uniprot P35871 8-52
  8. 1066698Domain d3d5b61: 3d5b 6:9-52 [157355]
    Other proteins in same PDB: d3d5b71, d3d5be1, d3d5bh1, d3d5bh2, d3d5bn1, d3d5bo1, d3d5bp1, d3d5bu1, d3d5bv1, d3d5by1, d3d5bz1
    automatically matched to 2J01 6:9-53
    complexed with mg

Details for d3d5b61

PDB Entry: 3d5b (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (6:) 50S ribosomal protein L33

SCOPe Domain Sequences for d3d5b61:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5b61 g.41.8.6 (6:9-52) Ribosomal protein L33p {Thermus thermophilus [TaxId: 274]}
lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrev

SCOPe Domain Coordinates for d3d5b61:

Click to download the PDB-style file with coordinates for d3d5b61.
(The format of our PDB-style files is described here.)

Timeline for d3d5b61: