Lineage for d3d5aq1 (3d5a Q:2-100)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 950107Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 950437Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 950757Protein Ribosomal protein S17 [50304] (3 species)
  7. 950787Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
    Uniprot P24321
  8. 950810Domain d3d5aq1: 3d5a Q:2-100 [157350]
    Other proteins in same PDB: d3d5ab1, d3d5ad1, d3d5ae1, d3d5af1, d3d5ag1, d3d5ah1, d3d5ai1, d3d5aj1, d3d5ak1, d3d5al1, d3d5an1, d3d5ao1, d3d5ap1, d3d5ar1, d3d5as1, d3d5at1, d3d5au1
    automatically matched to d1fjgq_
    complexed with mg, zn

Details for d3d5aq1

PDB Entry: 3d5a (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d3d5aq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5aq1 b.40.4.5 (Q:2-100) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslsk

SCOPe Domain Coordinates for d3d5aq1:

Click to download the PDB-style file with coordinates for d3d5aq1.
(The format of our PDB-style files is described here.)

Timeline for d3d5aq1: