Lineage for d3d5aj1 (3d5a J:3-100)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653555Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
    automatically mapped to Pfam PF00338
  5. 1653556Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 1653557Protein Ribosomal protein S10 [55001] (2 species)
  7. 1653583Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
    Uniprot P80375
  8. 1653607Domain d3d5aj1: 3d5a J:3-100 [157344]
    Other proteins in same PDB: d3d5ab1, d3d5ad1, d3d5ae1, d3d5af1, d3d5ag1, d3d5ah1, d3d5ai1, d3d5ak1, d3d5al1, d3d5an1, d3d5ao1, d3d5ap1, d3d5aq1, d3d5ar1, d3d5as1, d3d5at1, d3d5au1
    automatically matched to d1fjgj_
    complexed with mg, zn

Details for d3d5aj1

PDB Entry: 3d5a (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d3d5aj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5aj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOPe Domain Coordinates for d3d5aj1:

Click to download the PDB-style file with coordinates for d3d5aj1.
(The format of our PDB-style files is described here.)

Timeline for d3d5aj1: