Lineage for d3d5ai1 (3d5a I:2-128)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636635Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1636636Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1636637Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1636745Protein Ribosomal protein S9 [54218] (2 species)
  7. 1636773Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
    Uniprot P80374
  8. 1636793Domain d3d5ai1: 3d5a I:2-128 [157343]
    Other proteins in same PDB: d3d5ab1, d3d5ad1, d3d5ae1, d3d5af1, d3d5ag1, d3d5ah1, d3d5aj1, d3d5ak1, d3d5al1, d3d5an1, d3d5ao1, d3d5ap1, d3d5aq1, d3d5ar1, d3d5as1, d3d5at1, d3d5au1
    automatically matched to d1fjgi_
    complexed with mg, zn

Details for d3d5ai1

PDB Entry: 3d5a (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d3d5ai1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5ai1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOPe Domain Coordinates for d3d5ai1:

Click to download the PDB-style file with coordinates for d3d5ai1.
(The format of our PDB-style files is described here.)

Timeline for d3d5ai1: