Lineage for d3d5ae1 (3d5a E:5-154)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897616Family i.1.1.3: Small subunit [58132] (1 protein)
  6. 897617Protein 30S subunit [58133] (1 species)
  7. 897618Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 897622Domain d3d5ae1: 3d5a E:5-154 [157339]
    Other proteins in same PDB: d3d5ab1, d3d5ad1, d3d5af1, d3d5ag1, d3d5ah1, d3d5ai1, d3d5aj1, d3d5ak1, d3d5al1, d3d5an1, d3d5ao1, d3d5ap1, d3d5aq1, d3d5ar1, d3d5as1, d3d5at1, d3d5au1
    automatically matched to d1fkae_
    complexed with mg, zn

Details for d3d5ae1

PDB Entry: 3d5a (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d3d5ae1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5ae1 i.1.1.3 (E:5-154) 30S subunit {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
srnpiniayatmealrqlrtkadverlrkg

SCOP Domain Coordinates for d3d5ae1:

Click to download the PDB-style file with coordinates for d3d5ae1.
(The format of our PDB-style files is described here.)

Timeline for d3d5ae1: