Lineage for d3d5ad1 (3d5a D:2-209)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864567Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 864568Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 864569Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 864570Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 864601Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)
  8. 864623Domain d3d5ad1: 3d5a D:2-209 [157338]
    Other proteins in same PDB: d3d5ab1, d3d5ae1, d3d5af1, d3d5ag1, d3d5ah1, d3d5ai1, d3d5aj1, d3d5ak1, d3d5al1, d3d5an1, d3d5ao1, d3d5ap1, d3d5aq1, d3d5ar1, d3d5as1, d3d5at1, d3d5au1
    automatically matched to d1hnwd_
    complexed with mg, zn

Details for d3d5ad1

PDB Entry: 3d5a (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (D:) 30S ribosomal protein S4

SCOP Domain Sequences for d3d5ad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5ad1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOP Domain Coordinates for d3d5ad1:

Click to download the PDB-style file with coordinates for d3d5ad1.
(The format of our PDB-style files is described here.)

Timeline for d3d5ad1: