Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) common motif in otherwise different folds |
Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries) |
Domain d3d5ad1: 3d5a D:2-209 [157338] Other proteins in same PDB: d3d5ab1, d3d5ae1, d3d5af1, d3d5ag1, d3d5ah1, d3d5ai1, d3d5aj1, d3d5ak1, d3d5al1, d3d5an1, d3d5ao1, d3d5ap1, d3d5aq1, d3d5ar1, d3d5as1, d3d5at1, d3d5au1 automatically matched to d1hnwd_ complexed with mg, zn |
PDB Entry: 3d5a (more details), 3.21 Å
SCOP Domain Sequences for d3d5ad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5ad1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]} gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm kgkflrlpdredlalpvneqlviefysr
Timeline for d3d5ad1: