Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) |
Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) |
Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species) duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer |
Species Thermotoga maritima [TaxId:2336] [103083] (7 PDB entries) TM1246 |
Domain d3d54i1: 3d54 I:2-166 [157333] Other proteins in same PDB: d3d54a3, d3d54a4, d3d54e3, d3d54e4, d3d54i3, d3d54i4 automatically matched to d1vk3a1 complexed with adp, na |
PDB Entry: 3d54 (more details), 3.5 Å
SCOPe Domain Sequences for d3d54i1:
Sequence, based on SEQRES records: (download)
>d3d54i1 d.79.4.1 (I:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]} klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd yysvafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds
>d3d54i1 d.79.4.1 (I:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]} klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgnagvvnlddyys vafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiiegiad ygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds
Timeline for d3d54i1: