![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
![]() | Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
![]() | Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins) |
![]() | Domain d3d54e4: 3d54 E:508-603 [157332] Other proteins in same PDB: d3d54a1, d3d54a2, d3d54a3, d3d54e1, d3d54e2, d3d54e3, d3d54i1, d3d54i2, d3d54i3 automatically matched to d1vk3a4 complexed with adp, na missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 3d54 (more details), 3.5 Å
SCOPe Domain Sequences for d3d54e4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d54e4 d.139.1.1 (E:508-603) Phosphoribosylformylglycinamidine synthase II, domain 4 {Thermotoga maritima [TaxId: 2336]} akpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglki evklpevrpahqmvlvfsertpvvdvpvkeigtlsr
Timeline for d3d54e4: