Lineage for d1isca1 (1isc A:1-82)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633495Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 633496Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 633524Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)
  7. 633573Species Escherichia coli [TaxId:562] [46614] (6 PDB entries)
  8. 633584Domain d1isca1: 1isc A:1-82 [15733]
    Other proteins in same PDB: d1isca2, d1iscb2

Details for d1isca1

PDB Entry: 1isc (more details), 1.8 Å

PDB Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus
PDB Compounds: (A:) iron(III) superoxide dismutase

SCOP Domain Sequences for d1isca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1isca1 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]}
sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
ggvfnnaaqvwnhtfywnclap

SCOP Domain Coordinates for d1isca1:

Click to download the PDB-style file with coordinates for d1isca1.
(The format of our PDB-style files is described here.)

Timeline for d1isca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1isca2