![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
![]() | Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) ![]() |
![]() | Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins) |
![]() | Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species) duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer |
![]() | Species Thermotoga maritima [TaxId:2336] [103261] (7 PDB entries) TM1246 |
![]() | Domain d3d54a4: 3d54 A:508-603 [157328] Other proteins in same PDB: d3d54a1, d3d54a2, d3d54e1, d3d54e2, d3d54i1, d3d54i2 automatically matched to d1vk3a4 complexed with adp, na |
PDB Entry: 3d54 (more details), 3.5 Å
SCOPe Domain Sequences for d3d54a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d54a4 d.139.1.1 (A:508-603) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]} akpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglki evklpevrpahqmvlvfsertpvvdvpvkeigtlsr
Timeline for d3d54a4: