Lineage for d3d54a4 (3d54 A:508-603)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978140Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2978141Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2978142Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)
  6. Protein Phosphoribosylformylglycinamidine synthase II, domain 4 [419053] (1 species)
    protein duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. Species Thermotoga maritima [TaxId:2336] [419544] (7 PDB entries)
    TM1246
  8. 2978192Domain d3d54a4: 3d54 A:508-603 [157328]
    Other proteins in same PDB: d3d54a1, d3d54a2, d3d54a3, d3d54e1, d3d54e2, d3d54e3, d3d54i1, d3d54i2, d3d54i3
    automatically matched to d1vk3a4
    complexed with adp, na

    missing some secondary structures that made up less than one-third of the common domain

Details for d3d54a4

PDB Entry: 3d54 (more details), 3.5 Å

PDB Description: structure of purlqs from thermotoga maritima
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d3d54a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d54a4 d.139.1.1 (A:508-603) Phosphoribosylformylglycinamidine synthase II, domain 4 {Thermotoga maritima [TaxId: 2336]}
akpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglki
evklpevrpahqmvlvfsertpvvdvpvkeigtlsr

SCOPe Domain Coordinates for d3d54a4:

Click to download the PDB-style file with coordinates for d3d54a4.
(The format of our PDB-style files is described here.)

Timeline for d3d54a4: