Lineage for d3d54a1 (3d54 A:2-166)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209532Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1209969Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family) (S)
  5. 1209970Family d.79.4.1: PurM N-terminal domain-like [55327] (6 proteins)
  6. 1209985Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 1209986Species Thermotoga maritima [TaxId:2336] [103083] (7 PDB entries)
    TM1246
  8. 1209999Domain d3d54a1: 3d54 A:2-166 [157325]
    Other proteins in same PDB: d3d54a3, d3d54a4, d3d54e3, d3d54e4, d3d54i3, d3d54i4
    automatically matched to d1vk3a1
    complexed with adp, na

Details for d3d54a1

PDB Entry: 3d54 (more details), 3.5 Å

PDB Description: structure of purlqs from thermotoga maritima
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d3d54a1:

Sequence, based on SEQRES records: (download)

>d3d54a1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd
yysvafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg
iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds

Sequence, based on observed residues (ATOM records): (download)

>d3d54a1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgnagvvnlddyys
vafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiiegiad
ygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds

SCOPe Domain Coordinates for d3d54a1:

Click to download the PDB-style file with coordinates for d3d54a1.
(The format of our PDB-style files is described here.)

Timeline for d3d54a1: