SCOPe 2.08: Domain d3d54a1: 3d54 A:2-166

Lineage for d3d54a1 (3d54 A:2-166)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)

6. Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species)
   duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer

7. Species Thermotoga maritima [TaxId:2336] [103083] (7 PDB entries)
   TM1246

8. Domain d3d54a1: 3d54 A:2-166 [157325]
   Other proteins in same PDB: d3d54a3, d3d54a4, d3d54e3, d3d54e4, d3d54i3, d3d54i4
   automatically matched to d1vk3a1
   complexed with adp, na

Details for d3d54a1

PDB Entry: 3d54, 3.5 Å

PDB Description: structure of purlqs from thermotoga maritima

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d3d54a1:

Sequence, based on SEQRES records:

>d3d54a1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd
yysvafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg
iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds

Sequence, based on observed residues (ATOM records):

>d3d54a1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgnagvvnlddyys
vafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiiegiad
ygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds

Timeline for d3d54a1:

• d3d54a1 first appeared in SCOP 1.75
  
• d3d54a1 appears in SCOPe 2.07