SCOPe 2.04: Domain d3d51a3: 3d51 A:30-411

Lineage for d3d51a3 (3d51 A:30-411)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families)
   in the different families beta-barrels are similarly distorted but may vary in the number of strands

5. Family c.6.2.1: alpha-mannosidase [88714] (2 proteins)
   family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family

6. Protein Golgi alpha-mannosidase II [88715] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88716] (57 PDB entries)
   Uniprot Q24451 94-1107

8. Domain d3d51a3: 3d51 A:30-411 [157321]
   Other proteins in same PDB: d3d51a1, d3d51a2
   automated match to d1qwna3
   complexed with gox, mrd, zn

Details for d3d51a3

PDB Entry: 3d51, 1.43 Å

PDB Description: golgi mannosidase ii complex with gluco-hydroxyiminolactam

PDB Compounds: (A:) Alpha-mannosidase 2

SCOPe Domain Sequences for d3d51a3:

Sequence; same for both SEQRES and ATOM records:

>d3d51a3 c.6.2.1 (A:30-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qcqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphs
hndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqm
ksivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghs
ptmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysy
diphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaely
rtnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqa
eragqaefptlsgdfftyadrs

Timeline for d3d51a3:

• d3d51a3 first appeared in SCOP 1.75
  
• d3d51a3 appears in SCOPe 2.03
  
• d3d51a3 appears in SCOPe 2.05
  
• d3d51a3 appears in the current release, SCOPe 2.08