Lineage for d3d4nc1 (3d4n C:25-281)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 819766Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 819770Species Human (Homo sapiens) [TaxId:9606] [117424] (11 PDB entries)
    Uniprot P28845
  8. 819795Domain d3d4nc1: 3d4n C:25-281 [157298]
    automatically matched to d1xu9b_
    complexed with d4n, nap; mutant

Details for d3d4nc1

PDB Entry: 3d4n (more details), 2.5 Å

PDB Description: Crystal Structure of Human 11-beta-Hydroxysteroid Dehydrogenase (HSD1) in Complex with Sulfonamide Inhibitor
PDB Compounds: (C:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOP Domain Sequences for d3d4nc1:

Sequence, based on SEQRES records: (download)

>d3d4nc1 c.2.1.2 (C:25-281) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
eefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaa
sahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnf
lsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvs
rvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwt
tllirnpsrkileflys

Sequence, based on observed residues (ATOM records): (download)

>d3d4nc1 c.2.1.2 (C:25-281) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
eefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaa
sahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnf
lsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvs
rvnvsitlcvlglidtetamkavsgimqaapkeecaleiikggalrqeevyydsslwttl
lirnpsrkileflys

SCOP Domain Coordinates for d3d4nc1:

Click to download the PDB-style file with coordinates for d3d4nc1.
(The format of our PDB-style files is described here.)

Timeline for d3d4nc1: