Lineage for d3d3ra1 (3d3r A:1-76)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2061119Superfamily b.40.14: HupF/HypC-like [159127] (1 family) (S)
    contains extra C-terminal helix packed against the beta-barrel side
    automatically mapped to Pfam PF01455
  5. 2061120Family b.40.14.1: HupF/HypC-like [159128] (1 protein)
    Pfam PF01455
  6. 2061121Protein Hydrogenase expression/formation protein HypC [159129] (3 species)
  7. 2061124Species Shewanella oneidensis [TaxId:70863] [159131] (1 PDB entry)
    Uniprot Q8EF93 1-76
  8. 2061125Domain d3d3ra1: 3d3r A:1-76 [157285]
    Other proteins in same PDB: d3d3ra2, d3d3rb3

Details for d3d3ra1

PDB Entry: 3d3r (more details), 1.85 Å

PDB Description: Crystal structure of the hydrogenase assembly chaperone HypC/HupF family protein from Shewanella oneidensis MR-1
PDB Compounds: (A:) Hydrogenase assembly chaperone hypC/hupF

SCOPe Domain Sequences for d3d3ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d3ra1 b.40.14.1 (A:1-76) Hydrogenase expression/formation protein HypC {Shewanella oneidensis [TaxId: 70863]}
mclsipsqvvavdnerqsvtvdtlgvrrdvsshlmteplaigdyvlihigfvmnkidrnd
alqslelyqeivskle

SCOPe Domain Coordinates for d3d3ra1:

Click to download the PDB-style file with coordinates for d3d3ra1.
(The format of our PDB-style files is described here.)

Timeline for d3d3ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d3ra2