Lineage for d3d3ha_ (3d3h A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2533651Family d.2.1.10: PBP transglycosylase domain-like [159832] (3 proteins)
    Pfam PF00912; lacking the characteristic beta-sheet; otherwise has a similar fold to the Family 19 glycosidase
  6. 2533652Protein Penicillin-binding protein 1a, PBP1a [159833] (1 species)
  7. 2533653Species Aquifex aeolicus [TaxId:63363] [159834] (2 PDB entries)
    Uniprot O66874 57-243
  8. 2533654Domain d3d3ha_: 3d3h A: [157284]
    automated match to d2oqoa1
    complexed with m4o

Details for d3d3ha_

PDB Entry: 3d3h (more details), 2.31 Å

PDB Description: Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A
PDB Compounds: (A:) Penicillin-insensitive transglycosylase

SCOPe Domain Sequences for d3d3ha_:

Sequence, based on SEQRES records: (download)

>d3d3ha_ d.2.1.10 (A:) Penicillin-binding protein 1a, PBP1a {Aquifex aeolicus [TaxId: 63363]}
qkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaivnyragrivqggstitq
qlaknlfltrertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaqvy
fgkhvwelsldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqyeea
vnk

Sequence, based on observed residues (ATOM records): (download)

>d3d3ha_ d.2.1.10 (A:) Penicillin-binding protein 1a, PBP1a {Aquifex aeolicus [TaxId: 63363]}
qkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaiqggstitqqlaknlflt
rertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaqvyfgkhvwels
ldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqyeeavnk

SCOPe Domain Coordinates for d3d3ha_:

Click to download the PDB-style file with coordinates for d3d3ha_.
(The format of our PDB-style files is described here.)

Timeline for d3d3ha_: