Lineage for d1dt0c1 (1dt0 C:1-83)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690050Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2690078Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)
  7. 2690126Species Pseudomonas ovalis [TaxId:303] [46613] (2 PDB entries)
  8. 2690129Domain d1dt0c1: 1dt0 C:1-83 [15728]
    Other proteins in same PDB: d1dt0a2, d1dt0b2, d1dt0c2
    complexed with fe

Details for d1dt0c1

PDB Entry: 1dt0 (more details), 2.1 Å

PDB Description: cloning, sequence, and crystallographic structure of recombinant iron superoxide dismutase from pseudomonas ovalis
PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d1dt0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dt0c1 a.2.11.1 (C:1-83) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]}
afelpplpyahdalqphisketlefhhdkhhntyvvnlnnlvpgtefegktleeivktss
ggifnnaaqvwnhtfywnclspn

SCOPe Domain Coordinates for d1dt0c1:

Click to download the PDB-style file with coordinates for d1dt0c1.
(The format of our PDB-style files is described here.)

Timeline for d1dt0c1: