SCOPe 2.03: Domain d3d38l1: 3d38 L:1-273

Lineage for d3d38l1 (3d38 L:1-273)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81474] (10 PDB entries)

8. Domain d3d38l1: 3d38 L:1-273 [157276]
   Other proteins in same PDB: d3d38c1, d3d38h1, d3d38h2, d3d38m1
   automatically matched to d1prcl_
   complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1

Details for d3d38l1

PDB Entry: 3d38, 3.21 Å

PDB Description: Crystal structure of new trigonal form of photosynthetic reaction center from Blastochloris viridis. Crystals grown in microfluidics by detergent capture.

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d3d38l1:

Sequence; same for both SEQRES and ATOM records:

>d3d38l1 f.26.1.1 (L:1-273) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d3d38l1:

• d3d38l1 first appeared in SCOP 1.75
  
• d3d38l1 appears in SCOPe 2.02
  
• d3d38l1 appears in SCOPe 2.04
  
• d3d38l1 appears in the current release, SCOPe 2.08