SCOPe 2.08: Domain d3d38c1: 3d38 C:1-332

Lineage for d3d38c1 (3d38 C:1-332)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [48709] (28 PDB entries)

8. Domain d3d38c1: 3d38 C:1-332 [157273]
   Other proteins in same PDB: d3d38h1, d3d38h2, d3d38l1, d3d38m1
   automatically matched to d1prcc_
   complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1

Details for d3d38c1

PDB Entry: 3d38, 3.21 Å

PDB Description: Crystal structure of new trigonal form of photosynthetic reaction center from Blastochloris viridis. Crystals grown in microfluidics by detergent capture.

PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d3d38c1:

Sequence; same for both SEQRES and ATOM records:

>d3d38c1 a.138.1.2 (C:1-332) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

Timeline for d3d38c1:

• d3d38c1 first appeared in SCOP 1.75
  
• d3d38c1 appears in SCOPe 2.07