SCOPe 2.05: Domain d3d37b1: 3d37 B:6-178

Lineage for d3d37b1 (3d37 B:6-178)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.106: Phage tail proteins [69278] (1 superfamily)
   core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel

4. Superfamily b.106.1: Phage tail proteins [69279] (3 families)

5. Family b.106.1.1: Baseplate protein-like [69280] (3 proteins)
   duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions

6. Protein Baseplate protein gpP [159179] (3 species)
   43 kda tail protein; Pfam PF06893

7. Species Neisseria meningitidis [TaxId:487] [159180] (1 PDB entry)
   Uniprot Q9JZC8 179-347! Uniprot Q9JZC8 6-178
   unidentified prophage?

8. Domain d3d37b1: 3d37 B:6-178 [157271]
   automated match to d3d37a1
   complexed with cl

Details for d3d37b1

PDB Entry: 3d37, 2.1 Å

PDB Description: The crystal structure of the tail protein from Neisseria meningitidis MC58

PDB Compounds: (B:) Tail protein, 43 kDa

SCOPe Domain Sequences for d3d37b1:

Sequence, based on SEQRES records:

>d3d37b1 b.106.1.1 (B:6-178) Baseplate protein gpP {Neisseria meningitidis [TaxId: 487]}
ygyavsvrvggkehrhwerydidsdflipadsfdfvigrlgpeaaipdlsgescevvidg
qivmtgiigsqrhgkskgsrelslsgrdlagflvdcsapqlnvkgmtvldaakklaapwp
qikavvlkaennpalgkidiepgetvwqalthiansvglhpwlepdgtlvvgg

Sequence, based on observed residues (ATOM records):

>d3d37b1 b.106.1.1 (B:6-178) Baseplate protein gpP {Neisseria meningitidis [TaxId: 487]}
ygyavsvrvggkehrhwerydidsdflipadsfdfvipdlsgescevvidgqivmtgiig
sqrhgkskgsrelslsgrdlagflvdcsapqlnvkgmtvldaakklaapwpqikavvlka
ennpalgkidiepgetvwqalthiansvglhpwlepdgtlvvgg

Timeline for d3d37b1:

• d3d37b1 first appeared in SCOP 1.75
  
• d3d37b1 appears in SCOPe 2.04
  
• d3d37b1 appears in SCOPe 2.06
  
• d3d37b1 appears in the current release, SCOPe 2.08