SCOPe 2.06: Domain d3d32b_: 3d32 B:

Lineage for d3d32b_ (3d32 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein GABA(A) receptor associated protein GABARAP [69658] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69659] (6 PDB entries)

8. Domain d3d32b_: 3d32 B: [157268]
   Other proteins in same PDB: d3d32a3
   automated match to d1kota_
   complexed with cl, na, nh2

Details for d3d32b_

PDB Entry: 3d32, 1.3 Å

PDB Description: complex of gaba(a) receptor-associated protein (gabarap) with a synthetic peptide

PDB Compounds: (B:) Gamma-aminobutyric acid receptor-associated protein

SCOPe Domain Sequences for d3d32b_:

Sequence; same for both SEQRES and ATOM records:

>d3d32b_ d.15.1.3 (B:) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]}
mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvyg

Timeline for d3d32b_:

• d3d32b_ first appeared in SCOP 1.75, called d3d32b1
  
• d3d32b_ appears in SCOPe 2.05
  
• d3d32b_ appears in SCOPe 2.07
  
• d3d32b_ appears in the current release, SCOPe 2.08