![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
![]() | Protein GABA(A) receptor associated protein GABARAP [69658] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69659] (9 PDB entries) |
![]() | Domain d3d32b_: 3d32 B: [157268] Other proteins in same PDB: d3d32a3 automated match to d1kota_ complexed with cl, na |
PDB Entry: 3d32 (more details), 1.3 Å
SCOPe Domain Sequences for d3d32b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d32b_ d.15.1.3 (B:) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]} mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvyg
Timeline for d3d32b_: