Lineage for d3d31c1 (3d31 C:13-260)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2581051Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. 2581052Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. 2581053Family f.58.1.1: MetI-like [161099] (6 protein domains)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. 2581083Protein Sulfate/molybdate ABC transporter, permease protein [161100] (1 species)
  7. 2581084Species Methanosarcina acetivorans [TaxId:2214] [161101] (1 PDB entry)
    Uniprot Q8TTZ4 13-260
  8. 2581085Domain d3d31c1: 3d31 C:13-260 [157265]
    Other proteins in same PDB: d3d31a1, d3d31a2, d3d31b1, d3d31b2
    complexed with wo4

Details for d3d31c1

PDB Entry: 3d31 (more details), 3 Å

PDB Description: modbc from methanosarcina acetivorans
PDB Compounds: (C:) Sulfate/molybdate ABC transporter, permease protein

SCOPe Domain Sequences for d3d31c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d31c1 f.58.1.1 (C:13-260) Sulfate/molybdate ABC transporter, permease protein {Methanosarcina acetivorans [TaxId: 2214]}
pltfvfsflllvlflfifltlsnmifeqitedfsglvkaagnrsvissiflslyagflat
llalllgaptgyilarfdfpgkrlvesiidvpvvvphtvagialltvfgsrgligeples
yiqfrdalpgivvamlfvsmpylansaregfksvdprlenaarslgaplwkafffvtlpl
sarylligsvmtwaraisefgavvilayypmvgptliydrfisyglsasrpiavllilvt
lsiflvir

SCOPe Domain Coordinates for d3d31c1:

Click to download the PDB-style file with coordinates for d3d31c1.
(The format of our PDB-style files is described here.)

Timeline for d3d31c1: