SCOPe 2.07: Domain d3d2uh1: 3d2u H:4-97

Lineage for d3d2uh1 (3d2u H:4-97)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [49207] (5 PDB entries)
   Uniprot Q8NHL6 25-218

8. Domain d3d2uh1: 3d2u H:4-97 [157259]
   Other proteins in same PDB: d3d2ub_, d3d2uf_
   automatically matched to d1g0xa1
   complexed with bma, fuc, man, nag

Details for d3d2uh1

PDB Entry: 3d2u, 2.21 Å

PDB Description: structure of ul18, a peptide-binding viral mhc mimic, bound to a host inhibitory receptor

PDB Compounds: (H:) Leukocyte immunoglobulin-like receptor subfamily B member 1

SCOPe Domain Sequences for d3d2uh1:

Sequence; same for both SEQRES and ATOM records:

>d3d2uh1 b.1.1.4 (H:4-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
pkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktapwitripqelvkkgqfpip
sitwehagryrcyygsdtagrsessdplelvvtg

Timeline for d3d2uh1:

• d3d2uh1 first appeared in SCOP 1.75
  
• d3d2uh1 appears in SCOPe 2.06
  
• d3d2uh1 appears in the current release, SCOPe 2.08