Lineage for d3d2ud2 (3d2u D:98-198)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031531Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2031785Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2031786Species Human (Homo sapiens) [TaxId:9606] [49207] (5 PDB entries)
    Uniprot Q8NHL6 25-218
  8. 2031792Domain d3d2ud2: 3d2u D:98-198 [157257]
    Other proteins in same PDB: d3d2ub_, d3d2uf_
    automatically matched to d1g0xa2
    complexed with bma, fuc, man, nag

Details for d3d2ud2

PDB Entry: 3d2u (more details), 2.21 Å

PDB Description: structure of ul18, a peptide-binding viral mhc mimic, bound to a host inhibitory receptor
PDB Compounds: (D:) Leukocyte immunoglobulin-like receptor subfamily B member 1

SCOPe Domain Sequences for d3d2ud2:

Sequence, based on SEQRES records: (download)

>d3d2ud2 b.1.1.4 (D:98-198) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckegedehpqclnsqphargssra
ifsvgpvspsrrwwyrcyaydsnspyewslpsdllellvlg

Sequence, based on observed residues (ATOM records): (download)

>d3d2ud2 b.1.1.4 (D:98-198) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckeqclnssraifsvgpvspsrrw
wyrcyaydsnspyewslpsdllellvlg

SCOPe Domain Coordinates for d3d2ud2:

Click to download the PDB-style file with coordinates for d3d2ud2.
(The format of our PDB-style files is described here.)

Timeline for d3d2ud2: