| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species) possibly an intermediate structure between the I set and FnIII domains |
| Species Human (Homo sapiens) [TaxId:9606] [49207] (5 PDB entries) Uniprot Q8NHL6 25-218 |
| Domain d3d2ud2: 3d2u D:98-198 [157257] Other proteins in same PDB: d3d2ub_, d3d2uf_ automatically matched to d1g0xa2 complexed with bma, fuc, man, nag |
PDB Entry: 3d2u (more details), 2.21 Å
SCOPe Domain Sequences for d3d2ud2:
Sequence, based on SEQRES records: (download)
>d3d2ud2 b.1.1.4 (D:98-198) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckegedehpqclnsqphargssra
ifsvgpvspsrrwwyrcyaydsnspyewslpsdllellvlg
>d3d2ud2 b.1.1.4 (D:98-198) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckeqclnssraifsvgpvspsrrw
wyrcyaydsnspyewslpsdllellvlg
Timeline for d3d2ud2:
View in 3DDomains from other chains: (mouse over for more information) d3d2ub_, d3d2uf_, d3d2uh1, d3d2uh2 |