Lineage for d3d2ta_ (3d2t A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113483Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1113484Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
  6. 1113485Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 1113506Species Human (Homo sapiens) [TaxId:9606] [49475] (150 PDB entries)
    Uniprot P02766 31-143
  8. 1113715Domain d3d2ta_: 3d2t A: [157253]
    automated match to d1eta1_
    complexed with 1fl

Details for d3d2ta_

PDB Entry: 3d2t (more details), 1.85 Å

PDB Description: Human transthyretin (ttr) complexed with diflunisal
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d3d2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d2ta_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

SCOPe Domain Coordinates for d3d2ta_:

Click to download the PDB-style file with coordinates for d3d2ta_.
(The format of our PDB-style files is described here.)

Timeline for d3d2ta_: