Lineage for d3d2eb2 (3d2e B:189-382)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883725Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 2883806Species Human (Homo sapiens) [TaxId:9606] [53071] (7 PDB entries)
  8. 2883824Domain d3d2eb2: 3d2e B:189-382 [157246]
    automated match to d1ngfa2
    complexed with atp, gol, mg

Details for d3d2eb2

PDB Entry: 3d2e (more details), 2.35 Å

PDB Description: crystal structure of a complex of sse1p and hsp70, selenomethionine- labeled crystals
PDB Compounds: (B:) Heat shock 70 kDa protein 1

SCOPe Domain Sequences for d3d2eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d2eb2 c.55.1.1 (B:189-382) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens) [TaxId: 9606]}
gkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfveefkrk
hkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfeelcsd
lfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksinpdea
vaygaavqaailmg

SCOPe Domain Coordinates for d3d2eb2:

Click to download the PDB-style file with coordinates for d3d2eb2.
(The format of our PDB-style files is described here.)

Timeline for d3d2eb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d2eb1