SCOPe 2.03: Domain d3d2eb1: 3d2e B:4-188

Lineage for d3d2eb1 (3d2e B:4-188)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53071] (6 PDB entries)

8. Domain d3d2eb1: 3d2e B:4-188 [157245]
   automated match to d2qw9a1
   complexed with atp, gol, mg

Details for d3d2eb1

PDB Entry: 3d2e, 2.35 Å

PDB Description: crystal structure of a complex of sse1p and hsp70, selenomethionine- labeled crystals

PDB Compounds: (B:) Heat shock 70 kDa protein 1

SCOPe Domain Sequences for d3d2eb1:

Sequence; same for both SEQRES and ATOM records:

>d3d2eb1 c.55.1.1 (B:4-188) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens) [TaxId: 9606]}
aaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvalnp
qntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissmv
ltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaiay
gldrt

Timeline for d3d2eb1:

• d3d2eb1 first appeared in SCOP 1.75
  
• d3d2eb1 appears in SCOPe 2.02
  
• d3d2eb1 appears in SCOPe 2.04
  
• d3d2eb1 appears in the current release, SCOPe 2.08