SCOPe 2.06: Domain d3d29u2: 3d29 U:8-240

Lineage for d3d29u2 (3d29 U:8-240)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)

8. Domain d3d29u2: 3d29 U:8-240 [157239]
   Other proteins in same PDB: d3d291_, d3d292_, d3d29a_, d3d29b_, d3d29c2, d3d29c3, d3d29d_, d3d29e_, d3d29f_, d3d29g3, d3d29h_, d3d29i_, d3d29j_, d3d29k_, d3d29l_, d3d29m_, d3d29n_, d3d29o_, d3d29p_, d3d29q2, d3d29q3, d3d29r_, d3d29s_, d3d29t_, d3d29u3, d3d29v_, d3d29w_, d3d29x_, d3d29y_, d3d29z_
   automated match to d1g65g_
   complexed with feb

Details for d3d29u2

PDB Entry: 3d29, 2.6 Å

PDB Description: proteasome inhibition by fellutamide b

PDB Compounds: (U:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3d29u2:

Sequence; same for both SEQRES and ATOM records:

>d3d29u2 d.153.1.4 (U:8-240) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvsy
ifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytqr
aymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkkski
dhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiaeq
d

Timeline for d3d29u2:

• d3d29u2 first appeared in SCOP 1.75, called d3d29u1
  
• d3d29u2 was called d3d29u_ in SCOPe 2.05
  
• d3d29u2 appears in SCOPe 2.07
  
• d3d29u2 appears in the current release, SCOPe 2.08