Lineage for d3d27a1 (3d27 A:4-264)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872162Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 872163Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 872164Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 872219Protein Methionine aminopeptidase [55924] (5 species)
  7. 872228Species Escherichia coli [TaxId:562] [55925] (38 PDB entries)
    Uniprot P07906
  8. 872268Domain d3d27a1: 3d27 A:4-264 [157218]
    automatically matched to d1mata_
    complexed with mn, w29

Details for d3d27a1

PDB Entry: 3d27 (more details), 2.2 Å

PDB Description: E. coli methionine aminopeptidase with Fe inhibitor W29
PDB Compounds: (A:) Methionine aminopeptidase

SCOP Domain Sequences for d3d27a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d27a1 d.127.1.1 (A:4-264) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
gceiltlrkddtipaiishde

SCOP Domain Coordinates for d3d27a1:

Click to download the PDB-style file with coordinates for d3d27a1.
(The format of our PDB-style files is described here.)

Timeline for d3d27a1: