SCOP 1.75: Domain d3d1mb1: 3d1m B:41-188

Lineage for d3d1mb1 (3d1m B:41-188)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families)
   zinc-binding motif

5. Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (2 proteins)

6. Protein Sonic hedgehog [55171] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [55172] (2 PDB entries)

8. Domain d3d1mb1: 3d1m B:41-188 [157211]
   automatically matched to d1vhha_
   complexed with ca, zn

Details for d3d1mb1

PDB Entry: 3d1m, 1.7 Å

PDB Description: crystal structure of sonic hedgehog bound to the third fniii domain of cdo

PDB Compounds: (B:) Sonic hedgehog protein

SCOP Domain Sequences for d3d1mb1:

Sequence; same for both SEQRES and ATOM records:

>d3d1mb1 d.65.1.2 (B:41-188) Sonic hedgehog {Mouse (Mus musculus) [TaxId: 10090]}
tplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdeentgadrlmt
qrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrskyg
mlarlaveagfdwvyyeskahihcsvka

Timeline for d3d1mb1:

• d3d1mb1 is new in SCOP 1.75
  
• d3d1mb1 is called d3d1mb_ in SCOPe 2.01
  
• d3d1mb1 appears in the current release, SCOPe 2.08, called d3d1mb_