![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) ![]() zinc-binding motif |
![]() | Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins) automatically mapped to Pfam PF01085 |
![]() | Protein Sonic hedgehog [55171] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [55172] (4 PDB entries) |
![]() | Domain d3d1mb_: 3d1m B: [157211] Other proteins in same PDB: d3d1mc_, d3d1md_ automated match to d1vhha_ complexed with ca, zn |
PDB Entry: 3d1m (more details), 1.7 Å
SCOPe Domain Sequences for d3d1mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d1mb_ d.65.1.2 (B:) Sonic hedgehog {Mouse (Mus musculus) [TaxId: 10090]} ltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdeentgadrlm tqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsky gmlarlaveagfdwvyyeskahihcsvkae
Timeline for d3d1mb_: