Lineage for d3d1mb_ (3d1m B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956780Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2956781Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 2956786Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
    automatically mapped to Pfam PF01085
  6. 2956793Protein Sonic hedgehog [55171] (1 species)
  7. 2956794Species Mouse (Mus musculus) [TaxId:10090] [55172] (4 PDB entries)
  8. 2956797Domain d3d1mb_: 3d1m B: [157211]
    Other proteins in same PDB: d3d1mc_, d3d1md_
    automated match to d1vhha_
    complexed with ca, zn

Details for d3d1mb_

PDB Entry: 3d1m (more details), 1.7 Å

PDB Description: crystal structure of sonic hedgehog bound to the third fniii domain of cdo
PDB Compounds: (B:) Sonic hedgehog protein

SCOPe Domain Sequences for d3d1mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d1mb_ d.65.1.2 (B:) Sonic hedgehog {Mouse (Mus musculus) [TaxId: 10090]}
ltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdeentgadrlm
tqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsky
gmlarlaveagfdwvyyeskahihcsvkae

SCOPe Domain Coordinates for d3d1mb_:

Click to download the PDB-style file with coordinates for d3d1mb_.
(The format of our PDB-style files is described here.)

Timeline for d3d1mb_: