| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
| Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
| Protein Hemoglobin, alpha-chain [46486] (20 species) |
| Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (4 PDB entries) |
| Domain d3d1ka1: 3d1k A:1-142 [157208] Other proteins in same PDB: d3d1kb1 automatically matched to d1la6a_ complexed with ace, cmo, hem |
PDB Entry: 3d1k (more details), 1.25 Å
SCOP Domain Sequences for d3d1ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d1ka1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr
Timeline for d3d1ka1: