SCOPe 2.08: Domain d3d1ha_: 3d1h A:

Lineage for d3d1ha_ (3d1h A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (2 proteins)

6. Protein Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117584] (1 species)

7. Species Selenomonas ruminantium [TaxId:971] [117585] (12 PDB entries)
   Uniprot Q7WUJ1 34-346

8. Domain d3d1ha_: 3d1h A: [157206]
   automated match to d3moza_
   complexed with gol

Details for d3d1ha_

PDB Entry: 3d1h, 2.1 Å

PDB Description: structure of the ptp-like phytase expressed by selenomonas ruminantium at an ionic strength of 500 mm

PDB Compounds: (A:) myo-inositol hexaphosphate phosphohydrolase

SCOPe Domain Sequences for d3d1ha_:

Sequence; same for both SEQRES and ATOM records:

>d3d1ha_ c.45.1.4 (A:) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]}
tvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvps
regmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerd
wanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaag
mryfriaatdhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknps
vslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqt
pwsvwlkshpaka

Timeline for d3d1ha_:

• d3d1ha_ first appeared in SCOP 1.75, called d3d1ha1
  
• d3d1ha_ appears in SCOPe 2.07