SCOPe 2.08: Domain d3d1gb2: 3d1g B:123-244

Lineage for d3d1gb2 (3d1g B:123-244)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
   duplication: consists of three domains of this fold

6. Protein DNA polymerase III, beta subunit [55981] (2 species)

7. Species Escherichia coli [TaxId:562] [55982] (30 PDB entries)
   Uniprot P00583

8. Domain d3d1gb2: 3d1g B:123-244 [157204]
   automated match to d1ok7a2
   complexed with 322

Details for d3d1gb2

PDB Entry: 3d1g, 1.64 Å

PDB Description: structure of a small molecule inhibitor bound to a dna sliding clamp

PDB Compounds: (B:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d3d1gb2:

Sequence; same for both SEQRES and ATOM records:

>d3d1gb2 d.131.1.1 (B:123-244) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm
pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp
dy

Timeline for d3d1gb2:

• d3d1gb2 first appeared in SCOP 1.75
  
• d3d1gb2 appears in SCOPe 2.07