SCOPe 2.07: Domain d1bsha1: 1bsh A:87-138

Lineage for d1bsha1 (1bsh A:87-138)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.10: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46604] (2 families)

5. Family a.2.10.1: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46605] (1 protein)

6. Protein Epsilon subunit of F1F0-ATP synthase C-terminal domain [46606] (3 species)
   delta subunit in mitochondria
   this domain unfolds when bound to the gamma subunit

7. Species Escherichia coli [TaxId:562] [46607] (4 PDB entries)

8. Domain d1bsha1: 1bsh A:87-138 [15720]
   Other proteins in same PDB: d1bsha2

Details for d1bsha1

PDB Entry: 1bsh

PDB Description: solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex

PDB Compounds: (A:) protein (epsilon subunit)

SCOPe Domain Sequences for d1bsha1:

Sequence; same for both SEQRES and ATOM records:

>d1bsha1 a.2.10.1 (A:87-138) Epsilon subunit of F1F0-ATP synthase C-terminal domain {Escherichia coli [TaxId: 562]}
qdldearameakrkaeehissshgdvdyaqasaelakaiaqlrvieltkkam

Timeline for d1bsha1:

• d1bsha1 first appeared (with stable ids) in SCOP 1.55
  
• d1bsha1 appears in SCOPe 2.06
  
• d1bsha1 appears in the current release, SCOPe 2.08