Lineage for d1bsha1 (1bsh A:87-138)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690016Superfamily a.2.10: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46604] (2 families) (S)
  5. 2690017Family a.2.10.1: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46605] (1 protein)
  6. 2690018Protein Epsilon subunit of F1F0-ATP synthase C-terminal domain [46606] (3 species)
    delta subunit in mitochondria
    this domain unfolds when bound to the gamma subunit
  7. 2690031Species Escherichia coli [TaxId:562] [46607] (4 PDB entries)
  8. 2690034Domain d1bsha1: 1bsh A:87-138 [15720]
    Other proteins in same PDB: d1bsha2

Details for d1bsha1

PDB Entry: 1bsh (more details)

PDB Description: solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex
PDB Compounds: (A:) protein (epsilon subunit)

SCOPe Domain Sequences for d1bsha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsha1 a.2.10.1 (A:87-138) Epsilon subunit of F1F0-ATP synthase C-terminal domain {Escherichia coli [TaxId: 562]}
qdldearameakrkaeehissshgdvdyaqasaelakaiaqlrvieltkkam

SCOPe Domain Coordinates for d1bsha1:

Click to download the PDB-style file with coordinates for d1bsha1.
(The format of our PDB-style files is described here.)

Timeline for d1bsha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bsha2