Lineage for d3d1ea3 (3d1e A:245-366)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1927131Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1927132Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1927133Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. 1927134Protein DNA polymerase III, beta subunit [55981] (2 species)
  7. 1927135Species Escherichia coli [TaxId:562] [55982] (30 PDB entries)
    Uniprot P00583
  8. 1927186Domain d3d1ea3: 3d1e A:245-366 [157190]
    automatically matched to d1jqja3

Details for d3d1ea3

PDB Entry: 3d1e (more details), 1.9 Å

PDB Description: crystal structure of e. coli sliding clamp (beta) bound to a polymerase ii peptide
PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d3d1ea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d1ea3 d.131.1.1 (A:245-366) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
rrvlpknpdkhleagcdllkqafaraailsnekfrgvrlyvsenqlkitannpeqeeaee
ildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayvvmpm
rl

SCOPe Domain Coordinates for d3d1ea3:

Click to download the PDB-style file with coordinates for d3d1ea3.
(The format of our PDB-style files is described here.)

Timeline for d3d1ea3: