Lineage for d3d19f2 (3d19 F:145-274)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708948Superfamily a.29.13: Bacillus cereus metalloprotein-like [158430] (1 family) (S)
    Duplication: tandem repeat of two domains of this fold with similar sequences; binds a dimetal ion cluster between the repeats
    automatically mapped to Pfam PF11155
  5. 2708949Family a.29.13.1: Bacillus cereus metalloprotein-like [158431] (2 proteins)
  6. 2708992Protein Uncharacterized protein BCE_G9241_1042 [158432] (1 species)
  7. 2708993Species Bacillus cereus [TaxId:1396] [158433] (1 PDB entry)
    Uniprot Q4MW04 11-144! Uniprot Q4MW04 145-274
  8. 2709005Domain d3d19f2: 3d19 F:145-274 [157187]
    automated match to d3d19a2
    complexed with fe, mg

Details for d3d19f2

PDB Entry: 3d19 (more details), 2.3 Å

PDB Description: crystal structure of a conserved metalloprotein from bacillus cereus
PDB Compounds: (F:) Conserved metalloprotein

SCOPe Domain Sequences for d3d19f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d19f2 a.29.13.1 (F:145-274) Uncharacterized protein BCE_G9241_1042 {Bacillus cereus [TaxId: 1396]}
dalpdaiikenvfflrimadhakfighlldpserklvdtarnfsndfdelmyqaidlesm
kpqsqtaplldqfldqnrvsvaslrdfkktardlieqckiksiihplladhvfreadrfl
eiidmydvhl

SCOPe Domain Coordinates for d3d19f2:

Click to download the PDB-style file with coordinates for d3d19f2.
(The format of our PDB-style files is described here.)

Timeline for d3d19f2: