SCOPe 2.05: Domain d3d19d1: 3d19 D:16-144

Lineage for d3d19d1 (3d19 D:16-144)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.13: Bacillus cereus metalloprotein-like [158430] (1 family)
   Duplication: tandem repeat of two domains of this fold with similar sequences; binds a dimetal ion cluster between the repeats
   automatically mapped to Pfam PF11155

5. Family a.29.13.1: Bacillus cereus metalloprotein-like [158431] (2 proteins)

6. Protein Uncharacterized protein BCE_G9241_1042 [158432] (1 species)

7. Species Bacillus cereus [TaxId:1396] [158433] (1 PDB entry)
   Uniprot Q4MW04 11-144! Uniprot Q4MW04 145-274

8. Domain d3d19d1: 3d19 D:16-144 [157182]
   automated match to d3d19a1
   complexed with fe, mg

Details for d3d19d1

PDB Entry: 3d19, 2.3 Å

PDB Description: crystal structure of a conserved metalloprotein from bacillus cereus

PDB Compounds: (D:) Conserved metalloprotein

SCOPe Domain Sequences for d3d19d1:

Sequence; same for both SEQRES and ATOM records:

>d3d19d1 a.29.13.1 (D:16-144) Uncharacterized protein BCE_G9241_1042 {Bacillus cereus [TaxId: 1396]}
svmfverslneirfwsrimkehsfflrlgfrcedtqlieeanqfyrlfehieqiahsytn
etdpeqikrfnaevqqaatniwgfkrkilgliltcklpgqnnfpllvdhtsreadyfrkr
liqlnegkl

Timeline for d3d19d1:

• d3d19d1 first appeared in SCOP 1.75
  
• d3d19d1 appears in SCOPe 2.04
  
• d3d19d1 appears in SCOPe 2.06
  
• d3d19d1 appears in the current release, SCOPe 2.08