SCOP 1.57: Domain d1aqt_1: 1aqt 87-136

Lineage for d1aqt_1 (1aqt 87-136)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)

4. Superfamily a.2.10: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46604] (1 family)

5. Family a.2.10.1: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46605] (1 protein)

6. Protein Epsilon subunit of F1F0-ATP synthase C-terminal domain [46606] (2 species)

7. Species Escherichia coli [TaxId:562] [46607] (4 PDB entries)

8. Domain d1aqt_1: 1aqt 87-136 [15718]
   Other proteins in same PDB: d1aqt_2

Details for d1aqt_1

PDB Entry: 1aqt, 2.3 Å

PDB Description: epsilon subunit of f1f0-atp synthase from escherichia coli

SCOP Domain Sequences for d1aqt_1:

Sequence; same for both SEQRES and ATOM records:

>d1aqt_1 a.2.10.1 (87-136) Epsilon subunit of F1F0-ATP synthase C-terminal domain {Escherichia coli}
qdldearameakrkaeehissshgdvdyaqasaelakaiaqlrvieltkk

Timeline for d1aqt_1:

• d1aqt_1 first appeared (with stable ids) in SCOP 1.55
  
• d1aqt_1 appears in SCOP 1.59
  
• d1aqt_1 appears in the current release, SCOPe 2.08, called d1aqta1