Lineage for d3d0ge_ (3d0g E:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1448947Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 1448948Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
    automatically mapped to Pfam PF09408
  5. 1448949Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
    part of PfamB PB000266
  6. 1448950Protein Spike protein S1 [143589] (1 species)
  7. 1448951Species SARS coronavirus [TaxId:227859] [143590] (6 PDB entries)
    Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502
  8. 1448957Domain d3d0ge_: 3d0g E: [157170]
    Other proteins in same PDB: d3d0ga_, d3d0gb_
    automated match to d2ajfe1
    complexed with cl, nag, ndg, zn

Details for d3d0ge_

PDB Entry: 3d0g (more details), 2.8 Å

PDB Description: crystal structure of spike protein receptor-binding domain from the 2002-2003 sars coronavirus human strain complexed with human-civet chimeric receptor ace2
PDB Compounds: (E:) Spike protein S1

SCOPe Domain Sequences for d3d0ge_:

Sequence, based on SEQRES records: (download)

>d3d0ge_ d.318.1.1 (E:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnvy
adsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyryl
rhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

Sequence, based on observed residues (ATOM records): (download)

>d3d0ge_ d.318.1.1 (E:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnvyadsfvv
kgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylrhgklr
pferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

SCOPe Domain Coordinates for d3d0ge_:

Click to download the PDB-style file with coordinates for d3d0ge_.
(The format of our PDB-style files is described here.)

Timeline for d3d0ge_: