Lineage for d1qojb_ (1qoj B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760288Superfamily a.2.9: C-terminal UvrC-binding domain of UvrB [46600] (1 family) (S)
  5. 760289Family a.2.9.1: C-terminal UvrC-binding domain of UvrB [46601] (1 protein)
  6. 760290Protein C-terminal UvrC-binding domain of UvrB [46602] (1 species)
  7. 760291Species Escherichia coli [TaxId:562] [46603] (2 PDB entries)
  8. 760295Domain d1qojb_: 1qoj B: [15717]

Details for d1qojb_

PDB Entry: 1qoj (more details), 3 Å

PDB Description: crystal structure of e.coli uvrb c-terminal domain, and a model for uvrb-uvrc interaction.
PDB Compounds: (B:) uvrb

SCOP Domain Sequences for d1qojb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qojb_ a.2.9.1 (B:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]}
mspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas

SCOP Domain Coordinates for d1qojb_:

Click to download the PDB-style file with coordinates for d1qojb_.
(The format of our PDB-style files is described here.)

Timeline for d1qojb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qoja_