SCOP 1.59: Domain d1qojb_: 1qoj B:

Lineage for d1qojb_ (1qoj B:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)

4. Superfamily a.2.9: C-terminal, UvrC-binding domain of UvrB [46600] (1 family)

5. Family a.2.9.1: C-terminal, UvrC-binding domain of UvrB [46601] (1 protein)

6. Protein C-terminal, UvrC-binding domain of UvrB [46602] (1 species)

7. Species Escherichia coli [TaxId:562] [46603] (2 PDB entries)

8. Domain d1qojb_: 1qoj B: [15717]

Details for d1qojb_

PDB Entry: 1qoj, 3 Å

PDB Description: crystal structure of e.coli uvrb c-terminal domain, and a model for uvrb-uvrc interaction.

SCOP Domain Sequences for d1qojb_:

Sequence; same for both SEQRES and ATOM records:

>d1qojb_ a.2.9.1 (B:) C-terminal, UvrC-binding domain of UvrB {Escherichia coli}
mspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas

Timeline for d1qojb_:

• d1qojb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qojb_ appears in SCOP 1.57
  
• d1qojb_ appears in SCOP 1.61
  
• d1qojb_ appears in the current release, SCOPe 2.08