![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Pkb kinase (Akt-2) [82791] (1 species) AGC group; RAC/Akt subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82792] (16 PDB entries) |
![]() | Domain d3d0eb_: 3d0e B: [157169] automated match to d1o6ka_ complexed with g93 |
PDB Entry: 3d0e (more details), 2 Å
SCOPe Domain Sequences for d3d0eb_:
Sequence, based on SEQRES records: (download)
>d3d0eb_ d.144.1.7 (B:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta qsititppdrydslglleldqrthfpqfdysasir
>d3d0eb_ d.144.1.7 (B:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta qsititppdqrthfpqfdysasir
Timeline for d3d0eb_: