Lineage for d3czyb1 (3czy B:10-223)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777762Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 777763Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 777764Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)
  6. 777800Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 777801Species Human (Homo sapiens) [TaxId:9606] [48616] (20 PDB entries)
    Uniprot P09601
  8. 777809Domain d3czyb1: 3czy B:10-223 [157160]
    automatically matched to d1ni6c_
    complexed with ad8, hem

Details for d3czyb1

PDB Entry: 3czy (more details), 1.54 Å

PDB Description: Crystal Structure of Human Heme Oxygenase-1 in Complex with 1-(Adamantan-1-yl)-2-(1H-imidazol-1-yl)ethanone
PDB Compounds: (B:) Heme oxygenase 1

SCOP Domain Sequences for d3czyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3czyb1 a.132.1.1 (B:10-223) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOP Domain Coordinates for d3czyb1:

Click to download the PDB-style file with coordinates for d3czyb1.
(The format of our PDB-style files is described here.)

Timeline for d3czyb1: